PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00113750001
Common NameGSBRNA2T00113750001, LOC106367269, LOC106407582
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family NF-YA
Protein Properties Length: 184aa    MW: 20800.3 Da    PI: 9.2719
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00113750001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA107.41.2e-33100156158
            CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                          +ep++VNaKQy++Il+RRq+Rakle+++k+  ksrkpylheSRh hA+rRpRg+gGrF
  GSBRNA2T00113750001 100 EEPVFVNAKQYHGILRRRQSRAKLESQNKV-VKSRKPYLHESRHLHAIRRPRGCGGRF 156
                          69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005215.2E-3898159IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.64299159IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.8E-28101156IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.1E-24102124IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860104124IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.1E-24133156IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MASSVHDLSD KIETHDKQEH KDSQFQIQPP IPPGRNSAVY SEQLPHSMAP GHYPYPDPYY  60
RSMFAPNPQA YPPRPYETGV HAHLMGVQQQ CVPLPSDAVE EPVFVNAKQY HGILRRRQSR  120
AKLESQNKVV KSRKPYLHES RHLHAIRRPR GCGGRFLNAK KEEEHHEGNH LEEKSMAASG  180
GTS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-2199166168NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00113750001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893424e-87AC189342.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB042D24, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013703911.11e-134PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
RefseqXP_013703910.11e-134PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
RefseqXP_013662457.11e-134PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
RefseqXP_013662456.11e-134PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
SwissprotQ84JP11e-91NFYA7_ARATH; Nuclear transcription factor Y subunit A-7
TrEMBLA0A078ERW61e-134A0A078ERW6_BRANA; BnaA09g26040D protein
STRINGBra032395.1-P1e-133(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM41682756
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.22e-83nuclear factor Y, subunit A7
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]