![]() |
Plant Transcription
Factor Database
v4.0
Previous version:
v3.0
|
Home BLAST Prediction RegMap ATRM Download Help About Links |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00113750001 | ||||||||
Common Name | GSBRNA2T00113750001, LOC106367269, LOC106407582 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 184aa MW: 20800.3 Da PI: 9.2719 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 107.4 | 1.2e-33 | 100 | 156 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep++VNaKQy++Il+RRq+Rakle+++k+ ksrkpylheSRh hA+rRpRg+gGrF GSBRNA2T00113750001 100 EEPVFVNAKQYHGILRRRQSRAKLESQNKV-VKSRKPYLHESRHLHAIRRPRGCGGRF 156 69****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 5.2E-38 | 98 | 159 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 38.642 | 99 | 159 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 3.8E-28 | 101 | 156 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 2.1E-24 | 102 | 124 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 104 | 124 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 2.1E-24 | 133 | 156 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 184 aa Download sequence Send to blast |
MASSVHDLSD KIETHDKQEH KDSQFQIQPP IPPGRNSAVY SEQLPHSMAP GHYPYPDPYY 60 RSMFAPNPQA YPPRPYETGV HAHLMGVQQQ CVPLPSDAVE EPVFVNAKQY HGILRRRQSR 120 AKLESQNKVV KSRKPYLHES RHLHAIRRPR GCGGRFLNAK KEEEHHEGNH LEEKSMAASG 180 GTS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 1e-21 | 99 | 166 | 1 | 68 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00113750001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC189342 | 4e-87 | AC189342.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB042D24, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013703911.1 | 1e-134 | PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1 | ||||
Refseq | XP_013703910.1 | 1e-134 | PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1 | ||||
Refseq | XP_013662457.1 | 1e-134 | PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1 | ||||
Refseq | XP_013662456.1 | 1e-134 | PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1 | ||||
Swissprot | Q84JP1 | 1e-91 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
TrEMBL | A0A078ERW6 | 1e-134 | A0A078ERW6_BRANA; BnaA09g26040D protein | ||||
STRING | Bra032395.1-P | 1e-133 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4168 | 27 | 56 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G30500.2 | 2e-83 | nuclear factor Y, subunit A7 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 106367269 | 106407582 |
Publications ? help Back to Top | |||
---|---|---|---|
|